PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G010300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NF-YB
Protein Properties Length: 509aa    MW: 58037.7 Da    PI: 4.5073
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G010300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB87.31.7e-273613593
               NF-YB 35 vqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
                        vq cvsefi+f+tsea dkc+ ek+ t++g+dllwa+atlGf+dy+eplk+yl+kyr++
  Brast03G010300.1.p  3 VQACVSEFIAFITSEAGDKCRSEKQETMTGHDLLWAMATLGFQDYMEPLKLYLHKYRQV 61
                        89*******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.65E-18377IPR009072Histone-fold
PfamPF008081.9E-6339IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.106.9E-24383IPR009072Histone-fold
PRINTSPR006151.8E-13321No hitNo description
PRINTSPR006151.8E-132240No hitNo description
PRINTSPR006151.8E-134159No hitNo description
SuperFamilySSF520477.85E-10123139No hitNo description
Gene3DG3DSA:3.80.10.102.6E-21153420IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF813833.27E-10155221IPR001810F-box domain
PfamPF129371.8E-5157200IPR001810F-box domain
SuperFamilySSF520477.85E-10244317No hitNo description
SuperFamilySSF520477.85E-10348418No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MPVQACVSEF IAFITSEAGD KCRSEKQETM TGHDLLWAMA TLGFQDYMEP LKLYLHKYRQ  60
VCTGVAMDQP TDEGMGMEQH EQSEFMPPPH CNAFGIAEME HEKGEGQRPS GNLRPSEIIV  120
HQNCPELKTL ALPSTKVLPR AMEVDPNPLP VPEVRDWSEL PVDALSAIFT KLGTIEILMG  180
AGLVCHSWLE AAKLPELWRF MDMTRHKVVF SKAENVMCKM AKVAIDRSDG QMESFCAQKF  240
VSSELLDYIA SRGNSLKSIR VIASGFFWDD AVARLAAKCP MLEEIEYSHQ KHLGYFFKQL  300
GAVRPELKRL RIQMPWFDSD AIEREMRMEQ NHDEDEDEEE EPYEAWEARH NEGAFAIAAN  360
LHELRLLQMA GDSLTKKGVY AILEGCPHLE CLDLTECGHL EVDDELLARC ARIRHVWLPG  420
RWPRVHCPDL RTIEEDEGKV IEMDDDMYAM EARALRDEGA MECGDDYGDN YWEEYSTPSS  480
HGGDSPDLRN VTCDDTRYYT DFHEYYSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-203603693NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010234431.10.0PREDICTED: F-box protein SKIP19-like isoform X4
TrEMBLA0A0Q3JAZ00.0A0A0Q3JAZ0_BRADI; Uncharacterized protein
STRINGBRADI3G17357.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP548710
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.63e-26nuclear factor Y, subunit B1